PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0179s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 131aa    MW: 14705.2 Da    PI: 9.9998
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0179s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.26.7e-26958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien  nr vtfskRrng+ KKA+E+ vLCda+va+iif+s+gk+ +y+
  Cagra.0179s0008.1.p  9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMTDYC 58
                         79*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.375161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-38160IPR002100Transcription factor, MADS-box
CDDcd002651.29E-39280No hitNo description
SuperFamilySSF554553.14E-33289IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIIFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHEQQQEM AIASNARGMM MRGDHDGQFG YRVQPIQPNL  120
QEKIMSLVID *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A2e-16263162MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B2e-16263162MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1egw_A1e-16263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-16263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-16263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-16263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P2e-16163163Myocyte-specific enhancer factor 2B
1tqe_Q2e-16163163Myocyte-specific enhancer factor 2B
1tqe_R2e-16163163Myocyte-specific enhancer factor 2B
1tqe_S2e-16163163Myocyte-specific enhancer factor 2B
3mu6_A1e-16263162Myocyte-specific enhancer factor 2A
3mu6_B1e-16263162Myocyte-specific enhancer factor 2A
3mu6_C1e-16263162Myocyte-specific enhancer factor 2A
3mu6_D1e-16263162Myocyte-specific enhancer factor 2A
3p57_A2e-16263162Myocyte-specific enhancer factor 2A
3p57_B2e-16263162Myocyte-specific enhancer factor 2A
3p57_C2e-16263162Myocyte-specific enhancer factor 2A
3p57_D2e-16263162Myocyte-specific enhancer factor 2A
3p57_I2e-16263162Myocyte-specific enhancer factor 2A
3p57_J2e-16263162Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5517621e-124EU551762.1 Capsella bursa-pastoris PISTILLATA-like protein (PIa) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013665345.12e-58PREDICTED: floral homeotic protein PISTILLATA-like
RefseqXP_010420863.13e-57PREDICTED: floral homeotic protein PISTILLATA
SwissprotP480073e-58PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLF1A8F22e-57F1A8F2_BRANA; Pistillata (Fragment)
TrEMBLR0GXD94e-57R0GXD9_9BRAS; Uncharacterized protein
STRINGBra002285.1-P1e-56(Brassica rapa)
STRINGBra020093.1-P2e-56(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-59MIKC_MADS family protein